Recombinant E. coli ompC Protein, His-SUMO-tagged
Cat.No. : | ompC-1311E |
Product Overview : | Recombinant E. coli ompC Protein (22-367aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-367 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 54.3 kDa |
AA Sequence : | AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | ompC outer membrane porin protein C [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | ompC |
Synonyms | butR; ECK2207; JW2203; meoA; par |
Gene ID | 946716 |
Protein Refseq | NP_416719.1 |
UniProt ID | P06996 |
◆ Recombinant Proteins | ||
ompC-4130E | Recombinant Escherichia coli ompC protein, His-tagged | +Inquiry |
ompC-4131E | Recombinant Escherichia coli ompC protein | +Inquiry |
ompC-1311E | Recombinant E. coli ompC Protein, His-SUMO-tagged | +Inquiry |
ompC-4447K | Recombinant Klebsiella pneumoniae ompC protein, His&Myc-tagged | +Inquiry |
ompC-4714E | Recombinant Escherichia coli O157:H7 ompC protein, His-SUMO & Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ompC Products
Required fields are marked with *
My Review for All ompC Products
Required fields are marked with *
0
Inquiry Basket