Recombinant E.coli speA protein, His-tagged
| Cat.No. : | speA-325 |
| Product Overview : | Recombinant E.coli speA protein fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His |
| Description : | Biosynthetic arginine decarboxylase played an important role in many functions. Catalyzes the biosynthesis of agmatine from arginine. |
| Form : | PBS, pH 7.4, 50% glycerol |
| Molecular Mass : | 76kD |
| AA Sequence : | DDMSMGLPSSAGEHGVLRSMQEVAMSSQEASKMLRTYNIAWWGNNYYDVNELGHISVCPDPDVPEARVDLAQLV KTREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYGYNGDYFLVYPIKVNQHRRVIESLIHSGEPLGLEAG SKAELMAVLAHAGMTRSVIVCNGYKDREYIRLALIGEKMGHKVYLVIEKMSEIAIVLDEAERLNVVPRLGVRAR LASQGSGKWQSSGGEKSKFGLAATQVLQLVETL |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store at -20 centigrade, or for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Gene Name | speA biosynthetic arginine decarboxylase, PLP-binding [ Escherichia coli str. K-12 substr. MG1655 ] |
| Official Symbol | speA |
| Synonyms | ECK2933; JW2905; biosynthetic arginine decarboxylase, PLP-binding; biosynthetic arginine decarboxylase |
| Gene ID | 947432 |
| mRNA Refseq | |
| Protein Refseq | NP_417413 |
| MIM | |
| UniProt ID | P21170 |
| Pathway | Arginine and proline metabolism, organism-specific biosystem; L-arginine degradation III (arginine decarboxylase/agmatinase pathway), organism-specific biosystem; superpathway of arginine and polyamine biosynthesis, conserved biosystem |
| ◆ Recombinant Proteins | ||
| speA-4543S | Recombinant Streptococcus pyogenes speA protein, His-SUMO-tagged | +Inquiry |
| speA-325 | Recombinant E.coli speA protein, His-tagged | +Inquiry |
| speA-1401S | Recombinant Shewanella putrefaciens speA Protein (M1-S637), Flag/His-tagged | +Inquiry |
| SPEA-0149B | Recombinant Bacillus subtilis SPEA protein, His-tagged | +Inquiry |
| speA-1402S | Recombinant Shewanella putrefaciens speA Protein (M1-S637) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All speA Products
Required fields are marked with *
My Review for All speA Products
Required fields are marked with *



