"speA" Related Products

Recombinant E.coli speA protein, His-tagged

Cat.No.: speA-325
Product Overview: Recombinant E.coli speA protein fused with His tag was expressed in E. coli.
Description: Biosynthetic arginine decarboxylase played an important role in many functions. Catalyzes the biosynthesis of agmatine from arginine.
Source: E. coli
Species: E. coli
Tag: His
Form: PBS, pH 7.4, 50% glycerol
Molecular Mass: 76kD
AA Sequence: DDMSMGLPSSAGEHGVLRSMQEVAMSSQEASKMLRTYNIAWWGNNYYDVNELGHISVCPDPDVPEARVDLAQLV KTREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYGYNGDYFLVYPIKVNQHRRVIESLIHSGEPLGLEAG SKAELMAVLAHAGMTRSVIVCNGYKDREYIRLALIGEKMGHKVYLVIEKMSEIAIVLDEAERLNVVPRLGVRAR LASQGSGKWQSSGGEKSKFGLAATQVLQLVETL
Purity: >90% by SDS-PAGE
Storage: Store at -20 centigrade, or for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Gene Name: speA biosynthetic arginine decarboxylase, PLP-binding [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol: speA
Synonyms: ECK2933; JW2905; biosynthetic arginine decarboxylase, PLP-binding; biosynthetic arginine decarboxylase
Gene ID: 947432
mRNA Refseq:
Protein Refseq: NP_417413
MIM:
UniProt ID: P21170
Pathway: Arginine and proline metabolism, organism-specific biosystem; L-arginine degradation III (arginine decarboxylase/agmatinase pathway), organism-specific biosystem; superpathway of arginine and polyamine biosynthesis, conserved biosystem

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.