Recombinant Enhanced Green Fluorescent Protein, N-His and C-MYC tagged

• Cat.No.: eGFP-02
• Product Overview: Dual-tagged, recombinant enhanced Green Fluorescent Protein (eGFP, FPbase ID: R9NL8) produced in planta. Contains an N-terminal His-tag, followed by the TEV protease recognition and cleavage site (ENLYFQ|G), eGFP peptide and a C-terminal c-myc tag;
  Excitation: 488 nm
  Emission: 509 nm
  Isolectric Point: 5.925

Specification

• Source: Plant bioreactor fresh leaf tissue
• Tag: His&Myc
• Protein Length: 275AA
• Molecular Mass: 31.2 kDa
• AA Sequence: MASRSHHHHHHHDNKQENLYFQGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKEPALEQKLISEEDL
• Purity: >91% pure (by SDS-PAGE, RP-HPLC)
• Applications: SDS-PAGE, Western blots, fluorescence microscopy, fluorometry, ELISA.
• Storage: Lyophilized protein can be stored in a desiccator at -20 or -80 centigrade for at least 1 year.
  After reconstitution, aliquot and store at -20 centigrade.
  Avoid freeze-thaw cycles.
• Storage Buffer: Lyophilized in sterile conditions from a concentrated, 0.22 μm-filtered solution in PBS, pH=7.4.
• Reconstitution: Reconstitute with pure H20 or 1×PBS to a desired concentration, aliquote and store at -20 centigrade for up to 6 months. Store at -80 centigrade for longer periods. Avoid repeated freeze / thaw cycles.

Gene Information

• Official Symbol: eGFP
• Synonyms: eGFP; Enhanced Green Fluorescent Protein