Recombinant Enhanced Green Fluorescent Protein, N-His and C-MYC tagged

Cat.No. : eGFP-02
Product Overview : Dual-tagged, recombinant enhanced Green Fluorescent Protein (eGFP, FPbase ID: R9NL8) produced in planta. Contains an N-terminal His-tag, followed by the TEV protease recognition and cleavage site (ENLYFQ|G), eGFP peptide and a C-terminal c-myc tag;
Excitation: 488 nm
Emission: 509 nm
Isolectric Point: 5.925
Availability December 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Plant bioreactor fresh leaf tissue
Tag : His&Myc
Protein Length : 275AA
Molecular Mass : 31.2 kDa
AA Sequence : MASRSHHHHHHHDNKQENLYFQGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKEPALEQKLISEEDL
Purity : >91% pure (by SDS-PAGE, RP-HPLC)
Applications : SDS-PAGE, Western blots, fluorescence microscopy, fluorometry, ELISA.
Storage : Lyophilized protein can be stored in a desiccator at -20 or -80 centigrade for at least 1 year.
After reconstitution, aliquot and store at -20 centigrade.
Avoid freeze-thaw cycles.
Storage Buffer : Lyophilized in sterile conditions from a concentrated, 0.22 μm-filtered solution in PBS, pH=7.4.
Reconstitution : Reconstitute with pure H20 or 1×PBS to a desired concentration, aliquote and store at -20 centigrade for up to 6 months. Store at -80 centigrade for longer periods. Avoid repeated freeze / thaw cycles.
Official Symbol eGFP
Synonyms eGFP; Enhanced Green Fluorescent Protein

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All eGFP Products

Required fields are marked with *

My Review for All eGFP Products

Required fields are marked with *

0
cart-icon
0
compare icon