Recombinant Enhanced Green Fluorescent Protein, N-His and C-MYC tagged
Cat.No. : | eGFP-02 |
Product Overview : | Dual-tagged, recombinant enhanced Green Fluorescent Protein (eGFP, FPbase ID: R9NL8) produced in planta. Contains an N-terminal His-tag, followed by the TEV protease recognition and cleavage site (ENLYFQ|G), eGFP peptide and a C-terminal c-myc tag; Excitation: 488 nm Emission: 509 nm Isolectric Point: 5.925 |
Availability | September 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | Plant bioreactor fresh leaf tissue |
Tag : | His&Myc |
Protein Length : | 275AA |
Molecular Mass : | 31.2 kDa |
AA Sequence : | MASRSHHHHHHHDNKQENLYFQGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKEPALEQKLISEEDL |
Purity : | >91% pure (by SDS-PAGE, RP-HPLC) |
Applications : | SDS-PAGE, Western blots, fluorescence microscopy, fluorometry, ELISA. |
Storage : | Lyophilized protein can be stored in a desiccator at -20 or -80 centigrade for at least 1 year. After reconstitution, aliquot and store at -20 centigrade. Avoid freeze-thaw cycles. |
Storage Buffer : | Lyophilized in sterile conditions from a concentrated, 0.22 μm-filtered solution in PBS, pH=7.4. |
Reconstitution : | Reconstitute with pure H20 or 1×PBS to a desired concentration, aliquote and store at -20 centigrade for up to 6 months. Store at -80 centigrade for longer periods. Avoid repeated freeze / thaw cycles. |
Official Symbol | eGFP |
Synonyms | eGFP; Enhanced Green Fluorescent Protein |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All eGFP Products
Required fields are marked with *
My Review for All eGFP Products
Required fields are marked with *