Recombinant Enterobacteria phage MS2 Capsid Protein, His/Myc-tagged
Cat.No. : | Capsid-01E |
Product Overview : | Recombinant full length Enterobacteria phage MS2 Capsid Protein (2-130aa) with N-terminal 10xHis-tagged and C-terminal Myc-tagged o was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacteria phage MS2 |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-130aa |
Description : | Capsid protein self-assembles to form an icosahedral capsid with a T=3 symmetry, about 26 nm in diameter, and consisting of 89 capsid proteins dimers (178 capsid proteins). |
Form : | Liquid or Lyophilized powder |
Molecular Mass : | 21.2 kDa |
AA Sequence : | ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Purity : | > 85% as determined by SDS-PAGE. |
Stability : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20/-80 centigrade. The shelf life of lyophilized form is 12 months at -20/-80 centigrade. |
Storage : | Store at -20/-80 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
◆ Recombinant Proteins | ||
Capsid-422V | Recombinant Rubella Capsid C Protein | +Inquiry |
Capsid-375V | Recombinant Dengue Virus 1 Capsid Protein, His-tagged | +Inquiry |
Capsid-3912P | Recombinant Porcine parvovirus Capsid protein, His-tagged | +Inquiry |
Capsid-386V | Recombinant Zika Virus(Brazil) Capsid Protein, His-tagged | +Inquiry |
Capsid-757R | Recombinant Rubella Virus Capsid Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Capsid Products
Required fields are marked with *
My Review for All Capsid Products
Required fields are marked with *