Recombinant Epstein-Barr Virus EBNA3 Protein (1-138 aa), His-Myc-tagged

Cat.No. : EBNA3=2580E
Product Overview : Recombinant Epstein-Barr Virus (strain B95-8) (HHV-4) (Human herpesvirus 4) EBNA3 Protein (1-138 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HHV4
Source : E.coli
Tag : His&Myc
Protein Length : 1-138 aa
Description : Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 22.2 kDa
AA Sequence : MDKDRPGPPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAHLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Synonyms EBNA3;
UniProt ID P12977

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EBNA3 Products

Required fields are marked with *

My Review for All EBNA3 Products

Required fields are marked with *

0
cart-icon
0
compare icon