Recombinant Epstein-Barr Virus EBNA3 Protein (1-138 aa), His-Myc-tagged

• Cat.No.: EBNA3=2580E
• Product Overview: Recombinant Epstein-Barr Virus (strain B95-8) (HHV-4) (Human herpesvirus 4) EBNA3 Protein (1-138 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.

Specification

• Species: HHV4
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-138 aa
• Description: Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.2 kDa
• AA Sequence: MDKDRPGPPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAHLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: EBNA3
• UniProt ID: P12977