Recombinant Escherichia coaA Protein, His-tagged
Cat.No. : | coaA-1615E |
Product Overview : | Escherichia coli coaA (NP_418405, 1 a.a. - 316 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Description : | Pantothenate kinase catalyzes the first step in the biosynthesis of coenzyme A, an essential cofactor that is involved in many reactions. [More information is available at EcoCyc: EG10922]. |
Form : | Liquid |
Molecular Mass : | 38.9 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSHMSIKEQTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLRK |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 1 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (2 mM DTT, 10% glycerol) |
Gene Name | coaA pantothenate kinase [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | coaA |
Synonyms | coaA; pantothenate kinase; ECK3966; JW3942; panK; rts; ts-9 |
Gene ID | 948479 |
Protein Refseq | NP_418405 |
◆ Recombinant Proteins | ||
COAA-1340B | Recombinant Bacillus subtilis COAA protein, His-tagged | +Inquiry |
coaA-1615E | Recombinant Escherichia coaA Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All coaA Products
Required fields are marked with *
My Review for All coaA Products
Required fields are marked with *
0
Inquiry Basket