Recombinant Escherichia coaA Protein, His-tagged

• Cat.No.: coaA-1615E
• Product Overview: Escherichia coli coaA (NP_418405, 1 a.a. - 316 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His
• Description: Pantothenate kinase catalyzes the first step in the biosynthesis of coenzyme A, an essential cofactor that is involved in many reactions. [More information is available at EcoCyc: EG10922].
• Form: Liquid
• Molecular Mass: 38.9 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMSIKEQTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLRK
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 1 mg/mL
• Storage Buffer: In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (2 mM DTT, 10% glycerol)

Gene Information

• Gene Name: coaA pantothenate kinase [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: coaA
• Synonyms: coaA; pantothenate kinase; ECK3966; JW3942; panK; rts; ts-9
• Gene ID: 948479
• Protein Refseq: NP_418405