Recombinant Escherichia coaA Protein, His-tagged

Cat.No. : coaA-1615E
Product Overview : Escherichia coli coaA (NP_418405, 1 a.a. - 316 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Description : Pantothenate kinase catalyzes the first step in the biosynthesis of coenzyme A, an essential cofactor that is involved in many reactions. [More information is available at EcoCyc: EG10922].
Form : Liquid
Molecular Mass : 38.9 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSHMSIKEQTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLRK
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 1 mg/mL
Storage Buffer : In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (2 mM DTT, 10% glycerol)
Gene Name coaA pantothenate kinase [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol coaA
Synonyms coaA; pantothenate kinase; ECK3966; JW3942; panK; rts; ts-9
Gene ID 948479
Protein Refseq NP_418405

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All coaA Products

Required fields are marked with *

My Review for All coaA Products

Required fields are marked with *

0
cart-icon