Recombinant Escherichia coli ARSR Protein (1-117 aa), His-tagged
| Cat.No. : | ARSR-2623E |
| Product Overview : | Recombinant Escherichia coli (strain K12) ARSR Protein (1-117 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-117 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 19.0 kDa |
| AA Sequence : | MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHYRLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | arsR DNA-binding transcriptional repressor ArsR [ Escherichia coli str. K-12 substr. MG1655 ] |
| Official Symbol | ARSR |
| Synonyms | arsR; arsE; ECK3486; |
| Gene ID | 948013 |
| Protein Refseq | NP_417958 |
| UniProt ID | P37309 |
| ◆ Recombinant Proteins | ||
| ARSR-1840S | Recombinant Staphylococcus aureus (strain: TPS162) ARSR protein, His-tagged | +Inquiry |
| ARSR-2623E | Recombinant Escherichia coli ARSR Protein (1-117 aa), His-tagged | +Inquiry |
| ARSR-1081B | Recombinant Bacillus subtilis ARSR protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARSR Products
Required fields are marked with *
My Review for All ARSR Products
Required fields are marked with *
