Recombinant Escherichia coli ARSR Protein (1-117 aa), His-tagged
Cat.No. : | ARSR-2623E |
Product Overview : | Recombinant Escherichia coli (strain K12) ARSR Protein (1-117 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-117 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.0 kDa |
AA Sequence : | MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHYRLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | arsR DNA-binding transcriptional repressor ArsR [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | ARSR |
Synonyms | arsR; arsE; ECK3486; |
Gene ID | 948013 |
Protein Refseq | NP_417958 |
UniProt ID | P37309 |
◆ Recombinant Proteins | ||
ARSR-2623E | Recombinant Escherichia coli ARSR Protein (1-117 aa), His-tagged | +Inquiry |
ARSR-1840S | Recombinant Staphylococcus aureus (strain: TPS162) ARSR protein, His-tagged | +Inquiry |
ARSR-1081B | Recombinant Bacillus subtilis ARSR protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARSR Products
Required fields are marked with *
My Review for All ARSR Products
Required fields are marked with *