Recombinant Escherichia coli csrA protein
| Cat.No. : | csrA-4356E |
| Product Overview : | Recombinant Escherichia coli csrA protein(B1XCM4)(1-61aa), was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-61aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 6.9 kDa |
| AA Sequence : | MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| CSRA-1912E | Recombinant Escherichia coli CSRA Protein (1-61 aa), His-SUMO-tagged | +Inquiry |
| csrA-4355E | Recombinant Escherichia coli csrA protein, His-tagged | +Inquiry |
| csrA-4356E | Recombinant Escherichia coli csrA protein | +Inquiry |
| CSRA-0919B | Recombinant Bacillus subtilis CSRA protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All csrA Products
Required fields are marked with *
My Review for All csrA Products
Required fields are marked with *
