Recombinant Escherichia coli ELTA Protein (19-258 aa), His-Myc-tagged

Cat.No. : ELTA-2308E
Product Overview : Recombinant Escherichia coli ELTA Protein (19-258 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His&Myc
Protein Length : 19-258 aa
Description : The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 32.8 kDa
AA Sequence : NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name eltA heat-labile enterotoxin LT subunit A [ Escherichia coli O182:H21 ]
Official Symbol ELTA
Synonyms eltA;
Gene ID 39693531
UniProt ID P06717

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELTA Products

Required fields are marked with *

My Review for All ELTA Products

Required fields are marked with *

0
cart-icon
0
compare icon