Recombinant Escherichia coli ELTB Protein (22-124 aa), His-tagged

Cat.No. : ELTB-2353E
Product Overview : Recombinant Escherichia coli ELTB Protein (22-124 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal and C-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Protein Length : 22-124 aa
Description : The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 17 kDa
AA Sequence : APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name eltB heat-labile enterotoxin B subunit [ Escherichia coli ETEC H10407 ]
Official Symbol ELTB
Synonyms eltB;
Gene ID 8571464
UniProt ID P0CK94

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELTB Products

Required fields are marked with *

My Review for All ELTB Products

Required fields are marked with *

0
cart-icon
0
compare icon