Recombinant Escherichia coli ELTB Protein (22-124 aa), His-tagged
Cat.No. : | ELTB-2353E |
Product Overview : | Recombinant Escherichia coli ELTB Protein (22-124 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal and C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-124 aa |
Description : | The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17 kDa |
AA Sequence : | APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | eltB heat-labile enterotoxin B subunit [ Escherichia coli ETEC H10407 ] |
Official Symbol | ELTB |
Synonyms | eltB; |
Gene ID | 8571464 |
UniProt ID | P0CK94 |
◆ Recombinant Proteins | ||
ELTB-743C | Recombinant Clostridium perfringens ELTB protein, His-tagged | +Inquiry |
eltB-5543E | Recombinant Escherichia coli eltB protein, His&Myc-tagged | +Inquiry |
ELTB-2353E | Recombinant Escherichia coli ELTB Protein (22-124 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELTB Products
Required fields are marked with *
My Review for All ELTB Products
Required fields are marked with *