Recombinant Escherichia coli FANC Protein (23-181 aa)
Cat.No. : | FANC-2181E |
Product Overview : | Recombinant Escherichia coli FANC Protein (23-181 aa) is produced by E. coli expression system. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | Non |
Protein Length : | 23-181 aa |
Description : | Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. FanC is the main component of the K99 fimbriae. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.5 kDa |
AA Sequence : | NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | fanC; |
UniProt ID | P18103 |
◆ Recombinant Proteins | ||
FANC-2181E | Recombinant Escherichia coli FANC Protein (23-181 aa) | +Inquiry |
fanC-3901E | Recombinant Escherichia coli fanC protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FANC Products
Required fields are marked with *
My Review for All FANC Products
Required fields are marked with *
0
Inquiry Basket