Recombinant Escherichia coli LPTA Protein (28-185 aa), His-tagged
Cat.No. : | LPTA-1616E |
Product Overview : | Recombinant Escherichia coli (strain K12) LPTA Protein (28-185 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | Yeast |
Tag : | His |
Protein Length : | 28-185 aa |
Description : | Involved in the assbly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner mbrane to the outer mbrane. May form a bridge between the inner mbrane and the outer mbrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.3 kDa |
AA Sequence : | VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | lptA lipopolysaccharide transport system protein LptA [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | LPTA |
Synonyms | ECK3189; yhbN; |
Gene ID | 947920 |
Protein Refseq | NP_417667 |
UniProt ID | P0ADV1 |
◆ Recombinant Proteins | ||
LPTA-1616E | Recombinant Escherichia coli LPTA Protein (28-185 aa), His-tagged | +Inquiry |
LPTA-953E | Recombinant Escherichia coli LPTA Protein (28-185 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LPTA Products
Required fields are marked with *
My Review for All LPTA Products
Required fields are marked with *
0
Inquiry Basket