Recombinant Escherichia coli malE Protein, His-tagged
| Cat.No. : | malE-29E |
| Product Overview : | Recombinant Escherichia coli malE Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His |
| Description : | maltose ABC transporter periplasmic binding protein |
| Form : | Supplied as a 0.2 μm filtered solution in PBS (pH 7.4). |
| Molecular Mass : | ~40 kDa |
| AA Sequence : | MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 3.4 mg/ml |
| Official Full Name : | Maltose ABC transporter periplasmic binding protein |
| Gene Name | malE maltose ABC transporter periplasmic binding protein [ Escherichia coli str. K-12 substr. MG1655 ] |
| Official Symbol | malE |
| Synonyms | ECK4026 |
| Gene ID | 948538 |
| Protein Refseq | NP_418458 |
| UniProt ID | P0AEX9 |
| ◆ Recombinant Proteins | ||
| malE-4171E | Recombinant Escherichia coli malE protein, His&Myc-tagged | +Inquiry |
| malE-217E | Recombinant E.coli MalE, Maltose Binding Protein,His-tagged | +Inquiry |
| malE-29E | Recombinant Escherichia coli malE Protein, His-tagged | +Inquiry |
| malE-1287E | Recombinant E. coli (strain K12) malE Protein (Lys27-Thr392) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All malE Products
Required fields are marked with *
My Review for All malE Products
Required fields are marked with *
