Recombinant Escherichia coli malE Protein, His-tagged

• Cat.No.: malE-29E
• Product Overview: Recombinant Escherichia coli malE Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His
• Description: maltose ABC transporter periplasmic binding protein
• Form: Supplied as a 0.2 μm filtered solution in PBS (pH 7.4).
• Molecular Mass: ~40 kDa
• AA Sequence: MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 3.4 mg/ml
• Official Full Name: Maltose ABC transporter periplasmic binding protein

Gene Information

• Gene Name: malE maltose ABC transporter periplasmic binding protein [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: malE
• Synonyms: ECK4026
• Gene ID: 948538
• Protein Refseq: NP_418458
• UniProt ID: P0AEX9