Recombinant Escherichia coli OMPF Protein (23-362 aa), His-Myc-tagged
Cat.No. : | OMPF-2619E |
Product Overview : | Recombinant Escherichia coli (strain K12) OMPF Protein (23-362 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 23-362 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 44.1 kDa |
AA Sequence : | AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | ompF outer membrane porin F [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | OMPF |
Synonyms | ompF; cmlB; cry; ECK0920; nfxB; tolF; |
Gene ID | 945554 |
Protein Refseq | NP_415449 |
UniProt ID | P02931 |
◆ Recombinant Proteins | ||
OmpF-4839P | Recombinant Pseudomonas aeruginosa OmpF Protein, His-tagged | +Inquiry |
OMPF-2619E | Recombinant Escherichia coli OMPF Protein (23-362 aa), His-Myc-tagged | +Inquiry |
OmpF-4485S | Recombinant Salmonella typhimurium Outer membrane protein F (OmpF) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OMPF Products
Required fields are marked with *
My Review for All OMPF Products
Required fields are marked with *
0
Inquiry Basket