Recombinant Escherichia coli RPME Protein (50S) (1-70 aa), GST-tagged
| Cat.No. : | RPME-1243E |
| Product Overview : | Recombinant Escherichia coli (strain K12) RPME Protein (50S) (1-70 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-70 aa |
| Description : | Binds the 23S rRNA. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 34.9 kDa |
| AA Sequence : | MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRFNIPGSK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | rpmE 50S ribosomal subunit protein L31 [ Escherichia coli str. K-12 substr. MG1655 ] |
| Official Symbol | RPME |
| Synonyms | ECK3928; |
| Gene ID | 948425 |
| Protein Refseq | NP_418371 |
| UniProt ID | P0A7M9 |
| ◆ Recombinant Proteins | ||
| RPME-764S | Recombinant Streptomyces coelicolor A3(2) RPME protein, His-tagged | +Inquiry |
| RPME-0402B | Recombinant Bacillus subtilis RPME protein, His-tagged | +Inquiry |
| RPME-1243E | Recombinant Escherichia coli RPME Protein (50S) (1-70 aa), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPME Products
Required fields are marked with *
My Review for All RPME Products
Required fields are marked with *



