Recombinant Escherichia coli RPME Protein (50S) (1-70 aa), GST-tagged

Cat.No. : RPME-1243E
Product Overview : Recombinant Escherichia coli (strain K12) RPME Protein (50S) (1-70 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : GST
Protein Length : 1-70 aa
Description : Binds the 23S rRNA.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 34.9 kDa
AA Sequence : MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRFNIPGSK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name rpmE 50S ribosomal subunit protein L31 [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol RPME
Synonyms ECK3928;
Gene ID 948425
Protein Refseq NP_418371
UniProt ID P0A7M9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPME Products

Required fields are marked with *

My Review for All RPME Products

Required fields are marked with *

0
cart-icon
0
compare icon