Recombinant Escherichia coli RPSJ Protein (30S) (1-103 aa), GST-tagged
| Cat.No. : | RPSJ-1235E |
| Product Overview : | Recombinant Escherichia coli (strain K12) RPSJ Protein (30S) (1-103 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-103 aa |
| Description : | Involved in the binding of tRNA to the ribosomes. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 38.7 kDa |
| AA Sequence : | MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | rpsJ 30S ribosomal subunit protein S10 [ Escherichia coli str. K-12 substr. MG1655 ] |
| Official Symbol | RPSJ |
| Synonyms | ECK3308; nusE; |
| Gene ID | 947816 |
| Protein Refseq | NP_417780 |
| UniProt ID | P0A7R5 |
| ◆ Recombinant Proteins | ||
| RPSJ-0689B | Recombinant Bacillus subtilis RPSJ protein, His-tagged | +Inquiry |
| RPSJ-1142S | Recombinant Streptomyces coelicolor A3(2) RPSJ protein, His-tagged | +Inquiry |
| RPSJ-2883S | Recombinant Staphylococcus epidermidis ATCC 12228 RPSJ protein, His-tagged | +Inquiry |
| RPSJ-1235E | Recombinant Escherichia coli RPSJ Protein (30S) (1-103 aa), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPSJ Products
Required fields are marked with *
My Review for All RPSJ Products
Required fields are marked with *
