Recombinant Escherichia coli RPSR Protein (30S) (2-75 aa), GST-tagged
Cat.No. : | RPSR-1231E |
Product Overview : | Recombinant Escherichia coli (strain K12) RPSR Protein (30S) (2-75 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-75 aa |
Description : | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 35.9 kDa |
AA Sequence : | ARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDRHQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | rpsR 30S ribosomal subunit protein S18 [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | RPSR |
Synonyms | ECK4198; |
Gene ID | 948721 |
Protein Refseq | NP_418623 |
UniProt ID | P0A7T7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPSR Products
Required fields are marked with *
My Review for All RPSR Products
Required fields are marked with *