Recombinant Escherichia coli (strain K12) mazF protein(1-111aa), His-tagged
Cat.No. : | mazF-3432E |
Product Overview : | Recombinant Escherichia coli (strain K12) mazF protein(P0AE70)(1-111aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-111aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 13.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG |
◆ Recombinant Proteins | ||
mazF-3432E | Recombinant Escherichia coli (strain K12) mazF protein(1-111aa), His-tagged | +Inquiry |
MAZF-2597S | Recombinant Staphylococcus Epidermidis MAZF Protein (1-120 aa), His-tagged | +Inquiry |
mazF-453E | Recombinant Escherichia coli O157:H7 mazF protein, His-KSI-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mazF Products
Required fields are marked with *
My Review for All mazF Products
Required fields are marked with *
0
Inquiry Basket