Recombinant Fibrinogen C-terminal domain of Macaca fascicularis Angiopoietin-like protein 4 Protein, his-tagged
Cat.No. : | ANGPTL4-01H |
Product Overview : | Recombinant Fibrinogen C-terminal domain of Macaca fascicularis Angiopoietin-like protein 4 Protein with N-terminal his6 fusion tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca Fascicularis |
Source : | HEK293 |
Tag : | His |
Protein Length : | 247 |
Description : | Angiopoietin-like 4 (ANGPTL4), also known as FIAF, FARP, and PGAR. It contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain which can be proteolytically separated. The C-terminal fragment modulates cell adhesion through interactions with heparan sulfate proteoglycans, Integrins alpha 1 and beta 5, Vitronectin, and Fibronectin, thereby promoting keratinocyte migration and wound healing. |
Form : | Lyophilized powder |
Molecular Mass : | 27.9 kDa |
AA Sequence : | HHHHHHPEMAQPVDSAHNASRLHRLPRDCQELFEDGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPQGEFWLGLEKVHSITGDRNSRLAVQLQDWDGNAESLQFSVHLGGEDTAYSLQLTEPVASQLGATTVPPSSLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQELKKGIFWKTWRGRYYPLQATTMLIQPTAAEAAS |
Endotoxin : | <1EU/ug by LAL |
Purity : | > 90% by SDS-PAGE |
Applications : | Antigen for antibody production ELISA |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized from PBS, pH 7.4, 5% Trehalose, 5% Mannitol |
Gene Name | ANGPTL4 |
Official Symbol | ANGPTL4 |
Synonyms | ARP4, HFARP, PGAR |
Gene ID | 51129 |
mRNA Refseq | NM_139314.3 |
Protein Refseq | EHH59147.1 |
UniProt ID | A0A7N9D427 |
◆ Recombinant Proteins | ||
ANGPTL4-326R | Recombinant Rat ANGPTL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANGPTL4-5742H | Recombinant Human ANGPTL4 protein, His & GST-tagged | +Inquiry |
ANGPTL4-0519H | Recombinant Human ANGPTL4 Protein (His182-Tyr388), N-GST-tagged | +Inquiry |
ANGPTL4-1468C | Recombinant Cynomolgus ANGPTL4 protein, His-tagged | +Inquiry |
ANGPTL4-26H | Active Recombinant Human ANGPTL4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL4-1097HCL | Recombinant Human ANGPTL4 cell lysate | +Inquiry |
ANGPTL4-746MCL | Recombinant Mouse ANGPTL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPTL4 Products
Required fields are marked with *
My Review for All ANGPTL4 Products
Required fields are marked with *