Recombinant Fibrinogen C-terminal domain of Macaca fascicularis Angiopoietin-like protein 4 Protein, his-tagged

• Cat.No.: ANGPTL4-01H
• Product Overview: Recombinant Fibrinogen C-terminal domain of Macaca fascicularis Angiopoietin-like protein 4 Protein with N-terminal his6 fusion tag was expressed in HEK293.

Specification

• Species: Macaca Fascicularis
• Source: HEK293
• Tag: His
• Protein Length: 247
• Description: Angiopoietin-like 4 (ANGPTL4), also known as FIAF, FARP, and PGAR. It contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain which can be proteolytically separated. The C-terminal fragment modulates cell adhesion through interactions with heparan sulfate proteoglycans, Integrins alpha 1 and beta 5, Vitronectin, and Fibronectin, thereby promoting keratinocyte migration and wound healing.
• Form: Lyophilized powder
• Molecular Mass: 27.9 kDa
• AA Sequence: HHHHHHPEMAQPVDSAHNASRLHRLPRDCQELFEDGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPQGEFWLGLEKVHSITGDRNSRLAVQLQDWDGNAESLQFSVHLGGEDTAYSLQLTEPVASQLGATTVPPSSLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQELKKGIFWKTWRGRYYPLQATTMLIQPTAAEAAS
• Endotoxin: ＜1EU/ug by LAL
• Purity: > 90% by SDS-PAGE
• Applications: Antigen for antibody production
  ELISA
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from PBS, pH 7.4, 5% Trehalose, 5% Mannitol

Gene Information

• Gene Name: ANGPTL4
• Official Symbol: ANGPTL4
• Synonyms: ARP4, HFARP, PGAR
• Gene ID: 51129
• mRNA Refseq: NM_139314.3
• Protein Refseq: EHH59147.1
• UniProt ID: A0A7N9D427