Recombinant Fibrinogen C-terminal domain of Macaca fascicularis Angiopoietin-like protein 4 Protein, his-tagged
| Cat.No. : | ANGPTL4-01H |
| Product Overview : | Recombinant Fibrinogen C-terminal domain of Macaca fascicularis Angiopoietin-like protein 4 Protein with N-terminal his6 fusion tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Macaca Fascicularis |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 247 |
| Description : | Angiopoietin-like 4 (ANGPTL4), also known as FIAF, FARP, and PGAR. It contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain which can be proteolytically separated. The C-terminal fragment modulates cell adhesion through interactions with heparan sulfate proteoglycans, Integrins alpha 1 and beta 5, Vitronectin, and Fibronectin, thereby promoting keratinocyte migration and wound healing. |
| Form : | Lyophilized powder |
| Molecular Mass : | 27.9 kDa |
| AA Sequence : | HHHHHHPEMAQPVDSAHNASRLHRLPRDCQELFEDGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPQGEFWLGLEKVHSITGDRNSRLAVQLQDWDGNAESLQFSVHLGGEDTAYSLQLTEPVASQLGATTVPPSSLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQELKKGIFWKTWRGRYYPLQATTMLIQPTAAEAAS |
| Endotoxin : | <1EU/ug by LAL |
| Purity : | > 90% by SDS-PAGE |
| Applications : | Antigen for antibody production ELISA |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Lyophilized from PBS, pH 7.4, 5% Trehalose, 5% Mannitol |
| Gene Name | ANGPTL4 |
| Official Symbol | ANGPTL4 |
| Synonyms | ARP4, HFARP, PGAR |
| Gene ID | 51129 |
| mRNA Refseq | NM_139314.3 |
| Protein Refseq | EHH59147.1 |
| UniProt ID | A0A7N9D427 |
| ◆ Recombinant Proteins | ||
| Angptl4-405M | Recombinant Mouse Angiopoietin-like 4, FLAG-tagged | +Inquiry |
| ANGPTL4-495H | Recombinant Human ANGPTL4 Protein, His/DDK-tagged | +Inquiry |
| ANGPTL4-2472H | Recombinant Human ANGPTL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANGPTL4-2470H | Recombinant Human ANGPTL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANGPTL4-557H | Recombinant Human ANGPTL4 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANGPTL4-1097HCL | Recombinant Human ANGPTL4 cell lysate | +Inquiry |
| ANGPTL4-746MCL | Recombinant Mouse ANGPTL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPTL4 Products
Required fields are marked with *
My Review for All ANGPTL4 Products
Required fields are marked with *
