Recombinant Fibrinogen C-terminal domain of Macaca fascicularis Angiopoietin-like protein 4 Protein, his-tagged

Cat.No. : ANGPTL4-01H
Product Overview : Recombinant Fibrinogen C-terminal domain of Macaca fascicularis Angiopoietin-like protein 4 Protein with N-terminal his6 fusion tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Macaca Fascicularis
Source : HEK293
Tag : His
Protein Length : 247
Description : Angiopoietin-like 4 (ANGPTL4), also known as FIAF, FARP, and PGAR. It contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain which can be proteolytically separated. The C-terminal fragment modulates cell adhesion through interactions with heparan sulfate proteoglycans, Integrins alpha 1 and beta 5, Vitronectin, and Fibronectin, thereby promoting keratinocyte migration and wound healing.
Form : Lyophilized powder
Molecular Mass : 27.9 kDa
AA Sequence : HHHHHHPEMAQPVDSAHNASRLHRLPRDCQELFEDGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPQGEFWLGLEKVHSITGDRNSRLAVQLQDWDGNAESLQFSVHLGGEDTAYSLQLTEPVASQLGATTVPPSSLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQELKKGIFWKTWRGRYYPLQATTMLIQPTAAEAAS
Endotoxin : <1EU/ug by LAL
Purity : > 90% by SDS-PAGE
Applications : Antigen for antibody production
ELISA
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Lyophilized from PBS, pH 7.4, 5% Trehalose, 5% Mannitol
Gene Name ANGPTL4
Official Symbol ANGPTL4
Synonyms ARP4, HFARP, PGAR
Gene ID 51129
mRNA Refseq NM_139314.3
Protein Refseq EHH59147.1
UniProt ID A0A7N9D427

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANGPTL4 Products

Required fields are marked with *

My Review for All ANGPTL4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon