Recombinant FIV(isolate Petaluma) gag protein(1-135aa), His&Myc-tagged
| Cat.No. : | gag-5321F | 
| Product Overview : | Recombinant FIV(isolate Petaluma) gag protein(P16087)(1-135aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | FIV | 
| Source : | E.coli | 
| Tag : | His&Myc | 
| Protein Length : | 1-135aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 22.1 kDa | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| AA Sequence : | MGNGQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQAY | 
| ◆ Recombinant Proteins | ||
| gag-730V | Recombinant HIV gag Protein, His-tagged | +Inquiry | 
| gag-316H | Recombinant HIV gag, His-tagged | +Inquiry | 
| gag-4101H | Recombinant HIV-1 gag protein, GST-tagged | +Inquiry | 
| gag-315H | Recombinant HIV gag, His-tagged | +Inquiry | 
| gag-356V | Recombinant HIV gag Protein, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All gag Products
Required fields are marked with *
My Review for All gag Products
Required fields are marked with *
  
        
    
      
            