Recombinant Fruit fly mRpS10 protein, His-tagged
Cat.No. : | mRpS10-563F |
Product Overview : | Recombinant Fruit fly mRpS10 protein(Q9VFB2)(1-173aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Fruit fly |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-173aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MKMHMKHLDLYSQAIKTLRWTQPMRALSTVNTSSGVQGNLSPAAPAPEPDKLYSKLEIELRGIDPAVLKSYTWFATTAAEHLGIEKGKCWSPRKAHHERMTLLKSVHIYKKHRVQYEVRTHFRYMNFHKLTGSTLDTFLEYIERNLPEGVALQASRTELQEIPEHLRQPPEQV |
◆ Recombinant Proteins | ||
MRPS10-8854H | Recombinant Human MRPS10 protein, GST-tagged | +Inquiry |
MRPS10-453C | Recombinant Cynomolgus Monkey MRPS10 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS10-28171TH | Recombinant Human MRPS10, His-tagged | +Inquiry |
MRPS10-3436R | Recombinant Rat MRPS10 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS10-3777R | Recombinant Rat MRPS10 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS10-1134HCL | Recombinant Human MRPS10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mRpS10 Products
Required fields are marked with *
My Review for All mRpS10 Products
Required fields are marked with *
0
Inquiry Basket