Recombinant Human MRPS10, His-tagged

• Cat.No.: MRPS10-28171TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-201 of Human MRPS10 with an N terminal His tag; Predicted MWt 24 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-201 a.a.
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S10P family. Pseudogenes corresponding to this gene are found on chromosomes 1q, 3p, and 9p.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 134 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLST NMKWVQFSNLHVDVPKDLTKPVVTISDEPDILYKRLSV LVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIE RFTLLQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTAD VYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSE EKEESKS
• Full Length: Full L.

Gene Information

• Gene Name: MRPS10 mitochondrial ribosomal protein S10 [ Homo sapiens ]
• Official Symbol: MRPS10
• Synonyms: MRPS10; mitochondrial ribosomal protein S10; 28S ribosomal protein S10, mitochondrial; FLJ10567
• Gene ID: 55173
• mRNA Refseq: NM_018141
• Protein Refseq: NP_060611
• MIM: 611976
• Uniprot ID: P82664
• Chromosome Location: 6p21.1
• Function: molecular_function; structural constituent of ribosome