Recombinant Fruit Fly RPS3 Protein (1-246 aa), His-tagged

Cat.No. : RPS3-2481F
Product Overview : Recombinant Fruit Fly (Drosophila melanogaster) RPS3 Protein (1-246 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Fruit Fly
Source : E.coli
Tag : His
Protein Length : 1-246 aa
Description : Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta,delta elimination reaction.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 31.5 kDa
AA Sequence : MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name RpS3 Ribosomal protein S3 [ Drosophila melanogaster (fruit fly) ]
Official Symbol RPS3
Synonyms RpS3; 6779; CG6779; chr3R:19185518..19185701; Dmel\CG6779; DmRpS3; dS3; IP15838p; M; M(3)124; M(3)95A; M(3)B; M(3)B2; M(3)Fla; M(3)w; M(3R)w; M95A; Mw; M[[w]]; Rp S3; rps3; rpS3; Rps3; RPS3; RS3; S3; X72921;
Gene ID 42761
mRNA Refseq NM_001300552
Protein Refseq NP_001287481
UniProt ID Q06559

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPS3 Products

Required fields are marked with *

My Review for All RPS3 Products

Required fields are marked with *

0
cart-icon