Recombinant Fruit Fly RPS3 Protein (1-246 aa), His-tagged
| Cat.No. : | RPS3-2481F |
| Product Overview : | Recombinant Fruit Fly (Drosophila melanogaster) RPS3 Protein (1-246 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Fruit Fly |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-246 aa |
| Description : | Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta,delta elimination reaction. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 31.5 kDa |
| AA Sequence : | MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | RpS3 Ribosomal protein S3 [ Drosophila melanogaster (fruit fly) ] |
| Official Symbol | RPS3 |
| Synonyms | RpS3; 6779; CG6779; chr3R:19185518..19185701; Dmel\CG6779; DmRpS3; dS3; IP15838p; M; M(3)124; M(3)95A; M(3)B; M(3)B2; M(3)Fla; M(3)w; M(3R)w; M95A; Mw; M[[w]]; Rp S3; rps3; rpS3; Rps3; RPS3; RS3; S3; X72921; |
| Gene ID | 42761 |
| mRNA Refseq | NM_001300552 |
| Protein Refseq | NP_001287481 |
| UniProt ID | Q06559 |
| ◆ Recombinant Proteins | ||
| RPS3-3450H | Recombinant Human RPS3 protein, His-SUMO-tagged | +Inquiry |
| RPS3-30468TH | Recombinant Full Length Human RPS3 protein, His-tagged | +Inquiry |
| RPS3-14489M | Recombinant Mouse RPS3 Protein | +Inquiry |
| RPS3-480H | Recombinant Human RPS3, GST-tagged | +Inquiry |
| RPS3-5168R | Recombinant Rat RPS3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPS3-563HCL | Recombinant Human RPS3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPS3 Products
Required fields are marked with *
My Review for All RPS3 Products
Required fields are marked with *
