Recombinant Full Length Adeno-associated virus 2 (isolate Srivastava/1982) (AAV-2) Rep52 Protein, His tagged

• Cat.No.: Rep52-001V
• Product Overview: Recombinant Full Length Adeno-associated virus 2 (isolate Srivastava/1982) (AAV-2) Rep52 Protein with His tag was expressed in E. coli.

Specification

• Species: AAV2
• Source: E.coli
• Tag: His
• Protein Length: 1-397 aa
• Form: Lyophilized
• Molecular Mass: 45 kDa
• AA Sequence: MELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRYQNKCSRHVGMNLMLFPCRQCERMNQNSNICFTHGQKDCLECFPVSESQPVSVVKKAYQKLCYIHHIMGKVPDACTACDLVNVDLDDCIFEQHHHHHHHH
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile 50mM Tris, 300mM NaCl, pH 8.0, 5 % Mannitol, 5 % Trehalose.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 1.06 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.

Gene Information

• Official Symbol: Rep52
• Synonyms: Rep52