Recombinant Full Length Adeno-associated virus 2 (isolate Srivastava/1982) (AAV-2) Rep52 Protein, His tagged
Cat.No. : | Rep52-001V |
Product Overview : | Recombinant Full Length Adeno-associated virus 2 (isolate Srivastava/1982) (AAV-2) Rep52 Protein with His tag was expressed in E. coli. |
Availability | September 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | AAV2 |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-397 aa |
Form : | Lyophilized |
Molecular Mass : | 45 kDa |
AA Sequence : | MELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRYQNKCSRHVGMNLMLFPCRQCERMNQNSNICFTHGQKDCLECFPVSESQPVSVVKKAYQKLCYIHHIMGKVPDACTACDLVNVDLDDCIFEQHHHHHHHH |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile 50mM Tris, 300mM NaCl, pH 8.0, 5 % Mannitol, 5 % Trehalose. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 1.06 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
Official Symbol | Rep52 |
Synonyms | Rep52 |
◆ Recombinant Proteins | ||
Rep52-001V | Recombinant Full Length Adeno-associated virus 2 (isolate Srivastava/1982) (AAV-2) Rep52 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rep52 Products
Required fields are marked with *
My Review for All Rep52 Products
Required fields are marked with *