Recombinant Full Length Adenylate Cyclase 1(Cyaa) Protein, His-Tagged
Cat.No. : | RFL23724SF |
Product Overview : | Recombinant Full Length Adenylate cyclase 1(cyaA) Protein (P40137) (1-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Stigmatella aurantiaca |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-424) |
Form : | Lyophilized powder |
AA Sequence : | MMDAAGRTTQETLARTLESEQGHNALNLSWVRLLATSAVLIVSLYFGRVRGMTDWDVYTP PFAAYWSVTALTLVALYRFERLRRWAGLSLALVDVPAIYWLQHIALPLSPSPGGVAGFTL GLYATLILLSALSLRRTMTLVVTACAAVGEVALQREAHISLGAQLTAVVVLGACAAGACH LLLRIRTLLTTATQQELKRARLGRYFSPAVAERLQDLDRSETSPELREVTLLFADIRDFT SLSERLRPEQVVTLLNEYYGRMVEVVFRHGGTLDKFIGDALMVYFGAPIADPAHARRGVQ CALDMVQELETVNALRSARGEPCLRIGVGVHTGPAVLGNIGSATRRLEYTAIGDTVNLAS RIESLTKTRDVPILASRATREQAGDTFLWNEMAPASVPGKSQPVAIFTPRNRTPAQQAGA PAAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cyaA |
Synonyms | cyaA; Adenylate cyclase 1; ATP pyrophosphate-lyase 1; Adenylyl cyclase 1; AC 1 |
UniProt ID | P40137 |
◆ Recombinant Proteins | ||
CYAA-01B | Active Recombinant B. pertussis Adenylate Cyclase Protein, His tagged | +Inquiry |
CYAA-2737E | Recombinant Escherichia coli CYAA Protein (1-848 aa), His-tagged | +Inquiry |
cyaA-001B | Active Recombinant B. pertussi cyaA Protein | +Inquiry |
RFL23724SF | Recombinant Full Length Adenylate Cyclase 1(Cyaa) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All cyaA Products
Required fields are marked with *
My Review for All cyaA Products
Required fields are marked with *
0
Inquiry Basket