Recombinant Full Length Arabidopsis Thaliana Mechanosensitive Ion Channel Protein 1, Mitochondrial(Msl1) Protein, His-Tagged
Cat.No. : | RFL18464AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Mechanosensitive ion channel protein 1, mitochondrial(MSL1) Protein (Q8VZL4) (87-497aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (87-497) |
Form : | Lyophilized powder |
AA Sequence : | GSIVASGVTGSGDGNGNGNDWVEKAKDVLQTSVDAVTETAKKTKDVSDEMIPHVQQFLDS NPYLKDVIVPVSLTMTGTLFAWVVMPRILRRFHTYAMQSSAKLLPVGFSNEDVPYEKSFW GALEDPARYLVTFIAFAQIAAMVAPTTIAAQYFSPTVKGAVILSLVWFLYRWKTNVITRM LSAKSFGGLDREKVLTLDKVSSVGLFAIGLMASAEACGVAVQSILTVGGVGGVATAFAAR DILGNVLSGLSMQFSRPFSMGDTIKAGSVEGQVIEMGLTTTSLLNAEKFPVLVPNSLFSS QVIVNKSRAQWRAIASKIPLQIDDLDMIPQISNEIKEMLRSNTKVFLGKEAPHCYLSRVE KSFAELTIGCNLIRMGKEELYNTQQEVLLEAVKIIKKHGVSLGTTWDNSTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MSL1 |
Synonyms | MSL1; At4g00290; A_IG005I10.9; F5I10.9; Mechanosensitive ion channel protein 1, mitochondrial; Mechanosensitive channel of small conductance-like 1; MscS-Like protein 1 |
UniProt ID | Q8VZL4 |
◆ Recombinant Proteins | ||
MSL1-10137M | Recombinant Mouse MSL1 Protein | +Inquiry |
MSL1-5742M | Recombinant Mouse MSL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL18464AF | Recombinant Full Length Arabidopsis Thaliana Mechanosensitive Ion Channel Protein 1, Mitochondrial(Msl1) Protein, His-Tagged | +Inquiry |
MSL1-6563HF | Recombinant Full Length Human MSL1 Protein, GST-tagged | +Inquiry |
MSL1-5655H | Recombinant Human MSL1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSL1-423HCL | Recombinant Human MSL1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSL1 Products
Required fields are marked with *
My Review for All MSL1 Products
Required fields are marked with *
0
Inquiry Basket