Recombinant Full Length Arabidopsis Thaliana Probable Beta-1,3-Galactosyltransferase 4(B3Galt4) Protein, His-Tagged
Cat.No. : | RFL35550AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 4(B3GALT4) Protein (Q8LEJ9) (1-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-407) |
Form : | Lyophilized powder |
AA Sequence : | MSLKHHHRGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPESNVVSRDTVASDE RLRLESEDCDSSKKGLKRESKDILGDVYKSPDAIQTLDKTISKLETELADARAAQESIMN GSPVSDDFKLPETVTKRKYLMVVGVNTAFSSRKRRDSVRATWMPPGEERKKLEEEKGIVM RFVIGHSSTPGGILDRAIQAEESKHGDFLRLDHVEGYLELSAKTKTYFTTAFAMWDADFY VKVDDDVHVNIATLGAELARYRMKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKY FRHATGQLYAISRELASYISINQNVLHKYVNEDVSLGSWFLGLDVEHVDDRRLCCGTTDC EWKAQAGNICVASFDWSCSGICRSADRMKDVHRRCGEGEKALLAASF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | B3GALT4 |
Synonyms | B3GALT4; At4g26940; F10M23.280; Probable beta-1,3-galactosyltransferase 4 |
UniProt ID | Q8LEJ9 |
◆ Recombinant Proteins | ||
B3GALT4-010H | Recombinant Human B3GALT4 protein, GST-tagged | +Inquiry |
B3GALT4-2232M | Recombinant Mouse B3GALT4 Protein | +Inquiry |
B3GALT4-320R | Recombinant Rhesus Macaque B3GALT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
B3GALT4-1715HF | Recombinant Full Length Human B3GALT4 Protein, GST-tagged | +Inquiry |
B3GALT4-2325H | Recombinant Human B3GALT4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B3GALT4-8547HCL | Recombinant Human B3GALT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B3GALT4 Products
Required fields are marked with *
My Review for All B3GALT4 Products
Required fields are marked with *
0
Inquiry Basket