Recombinant Full Length Arabidopsis Thaliana Probable Beta-1,3-Galactosyltransferase 5(B3Galt5) Protein, His-Tagged
Cat.No. : | RFL9841AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 5(B3GALT5) Protein (Q9LM60) (1-398aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-398) |
Form : | Lyophilized powder |
AA Sequence : | MKHNNKVSKRLTMTWVPLLCISCFFLGAIFTSKLRSASSDSGSQLILQHRRDQELKIVTQ DYAHEKKKSQDNDVMEEVLKTHKAIESLDKSVSMLQKQLSATHSPQQIVNVSATNSSTEG NQKNKVFMVIGINTAFSSRKRRDSLRETWMPQGEKLEKLEKEKGIVVKFMIGHSSTPNSM LDKEIDSEDAQYNDFFRLDHVEGYYNLSAKTKSFFSSAVAKWDAEFYVKIDDDVHVNLGT LASTLASHRSKPRVYIGCMKSGPVLTKKTAKYREPEFWKFGEEGNKYFRHATGQIYAISK DLATYISNNQPILHKYANEDVTLGSWFIGLEVEQIDDRNFCCGTPPDCEMRAEAGEMCVA TFDWKCSGVCRSVDRMWMVHVMCGEGSKAVWDANLKLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | B3GALT5 |
Synonyms | B3GALT5; At1g22015; F2E2.6; Probable beta-1,3-galactosyltransferase 5 |
UniProt ID | Q9LM60 |
◆ Recombinant Proteins | ||
B3GALT5-22H | Recombinant Human B3GALT5 Protein (AA 32-310), N-6×His/GFP tagged | +Inquiry |
B3GALT5-1967H | Recombinant Human B3GALT5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
B3GALT5-0047H | Recombinant Human B3GALT5 Protein (Asn29-Val310), N-His-tagged | +Inquiry |
B3GALT5-1822H | Recombinant Human B3GALT5 protein, His & GST-tagged | +Inquiry |
B3galt5-1800M | Recombinant Mouse B3galt5 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B3GALT5-001HCL | Recombinant Human B3GALT5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B3GALT5 Products
Required fields are marked with *
My Review for All B3GALT5 Products
Required fields are marked with *
0
Inquiry Basket