Recombinant Human B3GALT5 Protein (AA 32-310), N-6×His/GFP tagged
Cat.No. : | B3GALT5-22H |
Product Overview : | Recombinant Human B3GALT5 Protein (AA 32-310) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GFP&His |
Protein Length : | AA 32-310 |
Description : | This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene. |
Molecular Mass : | ~70 kDa |
AA Sequence : | KEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV |
Purity : | >95%, by SDS-PAGE as visualized by Coomassie Blue Staining |
Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
Concentration : | 1 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
Preservative : | 0.05 % NaN3 |
Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
Gene Name | B3GALT5 beta-1,3-galactosyltransferase 5 [ Homo sapiens (human) ] |
Official Symbol | B3GALT5 |
Synonyms | B3GALT5; beta-1,3-galactosyltransferase 5; B3T5; GLCT5; B3GalTx; B3GalT-V; beta3Gal-T5; beta-3-Gx-T5; beta-1,3-GalTase 5; beta-1,3-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5; homolog of C. elegans Bt toxin resistance gene bre-5; EC 2.4.1.- |
Gene ID | 10317 |
mRNA Refseq | NM_006057 |
Protein Refseq | NP_006048 |
MIM | 604066 |
UniProt ID | Q9Y2C3 |
◆ Recombinant Proteins | ||
B3GALT5-0047H | Recombinant Human B3GALT5 Protein (Asn29-Val310), N-His-tagged | +Inquiry |
B3GALT5-1967H | Recombinant Human B3GALT5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
B3GALT5-1822H | Recombinant Human B3GALT5 protein, His & GST-tagged | +Inquiry |
B3GALT5-2233M | Recombinant Mouse B3GALT5 Protein | +Inquiry |
B3GALT5-925M | Recombinant Mouse B3GALT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B3GALT5-001HCL | Recombinant Human B3GALT5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B3GALT5 Products
Required fields are marked with *
My Review for All B3GALT5 Products
Required fields are marked with *
0
Inquiry Basket