Recombinant Full Length Arabidopsis Thaliana Ring-H2 Finger Protein Atl2(Atl2) Protein, His-Tagged
| Cat.No. : | RFL36584AF |
| Product Overview : | Recombinant Full Length Arabidopsis thaliana RING-H2 finger protein ATL2(ATL2) Protein (Q8L9T5) (1-304aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Arabidopsis thaliana |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-304) |
| Form : | Lyophilized powder |
| AA Sequence : | MNSNDQDPIPFRPEDNNFSGSKTYAMSGKIMLSAIVILFFVVILMVFLHLYARWYLLRAR RRHLRRRSRNRRATMVFFTADPSTAATSVVASRGLDPNVIKSLPVFTFSDETHKDPIECA VCLSEFEESETGRVLPNCQHTFHVDCIDMWFHSHSTCPLCRSLVESLAGIESTAAARERE VVIAVDSDPVLVIEPSSSSGLTDEPHGSGSSQMLREDSGRKPAAIEVPRRTFSEFEDELT RRDSPASQSFRSPMSRMLSFTRMLSRDRRSASSPIAGAPPLSPTLSCRIQMTESDIERGG EESR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ATL2 |
| Synonyms | ATL2; At3g16720; MGL6.19; RING-H2 finger protein ATL2; Protein ARABIDOPSIS TOXICOS EN LEVADURA 2; Protein ATL2; RING-type E3 ubiquitin transferase ATL2 |
| UniProt ID | Q8L9T5 |
| ◆ Recombinant Proteins | ||
| RFL3185HF | Recombinant Full Length Human Atlastin-2(Atl2) Protein, His-Tagged | +Inquiry |
| ATL2-4618H | Recombinant Human ATL2 protein, His-Myc-tagged | +Inquiry |
| ATL2-2092M | Recombinant Mouse ATL2 Protein | +Inquiry |
| RFL25730MF | Recombinant Full Length Macaca Fascicularis Atlastin-2(Atl2) Protein, His-Tagged | +Inquiry |
| ARL6IP2-818H | Recombinant Human ARL6IP2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATL2-122HCL | Recombinant Human ATL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATL2 Products
Required fields are marked with *
My Review for All ATL2 Products
Required fields are marked with *
