Recombinant Full Length Arabidopsis Thaliana Surfeit Locus Protein 1(Surf1) Protein, His-Tagged
| Cat.No. : | RFL31692AF |
| Product Overview : | Recombinant Full Length Arabidopsis thaliana Surfeit locus protein 1(SURF1) Protein (Q9SE51) (1-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Arabidopsis thaliana |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-354) |
| Form : | Lyophilized powder |
| AA Sequence : | MATSLSKILTRSNTKRYWCSTTTSISASPSLPKQFWSRHFSAVADSSSSSSAALGSQSSS SAPPQENKRGSKWSQLLLFLPGAITFGLGSWQIVRREEKFKTLEYQQQRLNMEPIKLNID HPLDKNLNALEFRRVSCKGVFDEQRSIYLGPRSRSISGITENGFFVITPLMPIPGDLDSM QSPILVNRGWVPRSWREKSQESAEAEFIANQSTKAKSPSNEPKSWWKFWSKTPVITKEHI SAVKPVEVVGVIRGGENPSIFVPSNDPSTGQWFYVDVPAMARAVGLPENTIYVEDVHEHV DRSRPYPVPKDINTLIRSKVMPQDHLNYSITWYSLSAAVTFMAYKRLKAKPVRR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SURF1 |
| Synonyms | SURF1; EMB3121; At3g17910; MEB5.13; Surfeit locus protein 1; Surfeit 1; Cytochrome c oxidase assembly protein SURF1; Protein EMBRYO DEFECTIVE 3121; Surfeit locus 1 cytochrome c oxidase biogenesis protein |
| UniProt ID | Q9SE51 |
| ◆ Recombinant Proteins | ||
| SURF1-16252M | Recombinant Mouse SURF1 Protein | +Inquiry |
| RFL31692AF | Recombinant Full Length Arabidopsis Thaliana Surfeit Locus Protein 1(Surf1) Protein, His-Tagged | +Inquiry |
| SURF1-3060H | Recombinant Human SURF1, His-tagged | +Inquiry |
| SURF1-1830H | Recombinant Human Surfeit 1, His tagged | +Inquiry |
| SURF1-5502R | Recombinant Rat SURF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SURF1-1337HCL | Recombinant Human SURF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SURF1 Products
Required fields are marked with *
My Review for All SURF1 Products
Required fields are marked with *
