Recombinant Full Length Rat Surfeit Locus Protein 1(Surf1) Protein, His-Tagged
Cat.No. : | RFL18658RF |
Product Overview : | Recombinant Full Length Rat Surfeit locus protein 1(Surf1) Protein (Q9QXU2) (1-306aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-306) |
Form : | Lyophilized powder |
AA Sequence : | MAAVMALTVLRSRITRWPQWACAGPAPFCAVRRSVFGFSVRSGMVCRPHRCCSSTAETAA AKAEDDSFLQWFLLFIPATAFGLGTWQVQRRKWKLKLIAELESRVMAEPIPLPADPMELK NLEYRPVKVRGHFDHSKELYIMPRTMVDPVREARDAGRLSSTESGAYVVTPFHCSDLGVT ILVNRGFVPRKKVNPETRQQGQVLGEVDLVGIVRLTENRKPFVPENNPERSLWYYRDLDA MAKRTGTDPIFIDADFNSTTPGGPIGGQTRVTLRNEHMQYIITWYGLCAATSYLWFRKFV RRTPGV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Surf1 |
Synonyms | Surf1; Surf-1; Surfeit locus protein 1 |
UniProt ID | Q9QXU2 |
◆ Recombinant Proteins | ||
RFL18658RF | Recombinant Full Length Rat Surfeit Locus Protein 1(Surf1) Protein, His-Tagged | +Inquiry |
RFL31692AF | Recombinant Full Length Arabidopsis Thaliana Surfeit Locus Protein 1(Surf1) Protein, His-Tagged | +Inquiry |
SURF1-1983C | Recombinant Chicken SURF1 | +Inquiry |
RFL25340GF | Recombinant Full Length Chicken Surfeit Locus Protein 1(Surf1) Protein, His-Tagged | +Inquiry |
SURF1-31483TH | Recombinant Human SURF1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SURF1-1337HCL | Recombinant Human SURF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Surf1 Products
Required fields are marked with *
My Review for All Surf1 Products
Required fields are marked with *