Recombinant Full Length Bovine Alpha-1,3-Mannosyl-Glycoprotein 4-Beta-N-Acetylglucosaminyltransferase A(Mgat4A) Protein, His-Tagged
Cat.No. : | RFL6902BF |
Product Overview : | Recombinant Full Length Bovine Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A(MGAT4A) Protein (O77836) (1-535aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-535) |
Form : | Lyophilized powder |
AA Sequence : | MRLRNGTVATVLAFITSFLTLSWYTTWQNGKEKVIAYQREFLALKERLRIAEHRISQRSSELSAIVQQFKRVEAETNRSKDPVNKFSDDTLKILKELTSKKSLQVPSIYYHLPHLLQNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDTDYVNGVVANLEKEFSKEISSGLVEIISPPESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQEKGTYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLTGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPVAGDYILFKFDKPVNVESYLFHSGNQDHPGDILLNTTVEVLPLKSEGLDISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKVTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MGAT4A |
Synonyms | MGAT4A; Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa; GlcNAc-T IVa; GnT-IVa; N-acetylglucosaminyltransferase IVa; UDP-N-acetylglucosamine: alpha-1,3-D |
UniProt ID | O77836 |
◆ Recombinant Proteins | ||
MGAT4A-3295B | Recombinant Bovine MGAT4A, His-tagged | +Inquiry |
MGAT4A-3327R | Recombinant Rat MGAT4A Protein, His (Fc)-Avi-tagged | +Inquiry |
MGAT4A-436C | Recombinant Cynomolgus Monkey MGAT4A Protein, His (Fc)-Avi-tagged | +Inquiry |
MGAT4A-5935H | Recombinant Human MGAT4A protein, His&Myc-tagged | +Inquiry |
MGAT4A-2909H | Recombinant Human MGAT4A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGAT4A-4342HCL | Recombinant Human MGAT4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGAT4A Products
Required fields are marked with *
My Review for All MGAT4A Products
Required fields are marked with *
0
Inquiry Basket