Recombinant Full Length Bovine Cytochrome C Oxidase Subunit 6A2, Mitochondrial(Cox6A2) Protein, His-Tagged
Cat.No. : | RFL2806BF |
Product Overview : | Recombinant Full Length Bovine Cytochrome c oxidase subunit 6A2, mitochondrial(COX6A2) Protein (P07471) (13-97aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (13-97) |
Form : | Lyophilized powder |
AA Sequence : | ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPF SWGDGNHTFFHNPRVNPLPTGYEKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COX6A2 |
Synonyms | COX6A2; COX6A; Cytochrome c oxidase subunit 6A2, mitochondrial; Cytochrome c oxidase polypeptide VIa-heart; COXVIAH; Cytochrome c oxidase polypeptide VIb |
UniProt ID | P07471 |
◆ Recombinant Proteins | ||
COX6A2-1741HFL | Recombinant Full Length Human COX6A2 Protein, C-Flag-tagged | +Inquiry |
Cox6a2-928M | Recombinant Mouse Cox6a2 Protein, MYC/DDK-tagged | +Inquiry |
COX6A2-816R | Recombinant Rhesus Macaque COX6A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX6A2-1388Z | Recombinant Zebrafish COX6A2 | +Inquiry |
RFL2806BF | Recombinant Full Length Bovine Cytochrome C Oxidase Subunit 6A2, Mitochondrial(Cox6A2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX6A2-7330HCL | Recombinant Human COX6A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX6A2 Products
Required fields are marked with *
My Review for All COX6A2 Products
Required fields are marked with *