Recombinant Full Length Bovine Dnaj Homolog Subfamily C Member 22(Dnajc22) Protein, His-Tagged
Cat.No. : | RFL24930BF |
Product Overview : | Recombinant Full Length Bovine DnaJ homolog subfamily C member 22(DNAJC22) Protein (Q17QW0) (1-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-347) |
Form : | Lyophilized powder |
AA Sequence : | MAKGLLMTYTLWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWMLPSFVAQAN RAQEQRQGSGRGTPPLSLIRFVAQMIVGMYFGLVALISLSFMASFYIVGLPLAVGLGVLL VAAVGNQTSDLKNTLGAAFLTSPIFYGRPIAILPISLAASITAQKHRRYKPSVGSETLSV RLYRLGLAYLAFTGPLVHSVLCHTAVTLSYVADTLGSFLSWFSFFPLLGRLLESVLLLPF RAWKLLVGDHGISSSYFQEWEKLYEFVHSFQDEKRQLALQVFGLSEGATNEEIHGRYREL VKTWHPDHNRYQMEEAQRRFLEIQAAYEVLRQPRKPRGSWRWEETSF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DNAJC22 |
Synonyms | DNAJC22; DnaJ homolog subfamily C member 22 |
UniProt ID | Q17QW0 |
◆ Recombinant Proteins | ||
RFL9197HF | Recombinant Full Length Human Dnaj Homolog Subfamily C Member 22(Dnajc22) Protein, His-Tagged | +Inquiry |
DNAJC22-1909R | Recombinant Rat DNAJC22 Protein | +Inquiry |
DNAJC22-1568R | Recombinant Rat DNAJC22 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC22-1292R | Recombinant Rhesus monkey DNAJC22 Protein, His-tagged | +Inquiry |
RFL26926PF | Recombinant Full Length Pongo Abelii Dnaj Homolog Subfamily C Member 22(Dnajc22) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJC22-632HCL | Recombinant Human DNAJC22 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC22 Products
Required fields are marked with *
My Review for All DNAJC22 Products
Required fields are marked with *