Recombinant Full Length Human DNAJC22 Protein, GST-tagged

Cat.No. : DNAJC22-4862HF
Product Overview : Human FLJ13236 full-length ORF ( NP_079178.2, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 341 amino acids
Description : DNAJC22 (DnaJ Heat Shock Protein Family (Hsp40) Member C22) is a Protein Coding gene. Diseases associated with DNAJC22 include Leukoencephalopathy With Vanishing White Matter. GO annotations related to this gene include unfolded protein binding and chaperone binding.
Molecular Mass : 64.5 kDa
AA Sequence : MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFLTSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAJC22 DnaJ (Hsp40) homolog, subfamily C, member 22 [ Homo sapiens ]
Official Symbol DNAJC22
Synonyms DNAJC22; DnaJ (Hsp40) homolog, subfamily C, member 22; dnaJ homolog subfamily C member 22; FLJ13236; wurst homolog (Drosophila); wus; wurst homolog;
Gene ID 79962
mRNA Refseq NM_024902
Protein Refseq NP_079178
UniProt ID Q8N4W6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJC22 Products

Required fields are marked with *

My Review for All DNAJC22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon