Recombinant Full Length Human DNAJC22 Protein, GST-tagged
Cat.No. : | DNAJC22-4862HF |
Product Overview : | Human FLJ13236 full-length ORF ( NP_079178.2, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 341 amino acids |
Description : | DNAJC22 (DnaJ Heat Shock Protein Family (Hsp40) Member C22) is a Protein Coding gene. Diseases associated with DNAJC22 include Leukoencephalopathy With Vanishing White Matter. GO annotations related to this gene include unfolded protein binding and chaperone binding. |
Molecular Mass : | 64.5 kDa |
AA Sequence : | MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFLTSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAJC22 DnaJ (Hsp40) homolog, subfamily C, member 22 [ Homo sapiens ] |
Official Symbol | DNAJC22 |
Synonyms | DNAJC22; DnaJ (Hsp40) homolog, subfamily C, member 22; dnaJ homolog subfamily C member 22; FLJ13236; wurst homolog (Drosophila); wus; wurst homolog; |
Gene ID | 79962 |
mRNA Refseq | NM_024902 |
Protein Refseq | NP_079178 |
UniProt ID | Q8N4W6 |
◆ Recombinant Proteins | ||
DNAJC22-1117R | Recombinant Rhesus Macaque DNAJC22 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC22-4709M | Recombinant Mouse DNAJC22 Protein | +Inquiry |
DNAJC22-2451M | Recombinant Mouse DNAJC22 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC22-4243H | Recombinant Human DNAJC22 Protein, GST-tagged | +Inquiry |
DNAJC22-4862HF | Recombinant Full Length Human DNAJC22 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJC22-632HCL | Recombinant Human DNAJC22 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC22 Products
Required fields are marked with *
My Review for All DNAJC22 Products
Required fields are marked with *
0
Inquiry Basket