Recombinant Full Length Bovine Gamma-Secretase Subunit Pen-2(Psenen) Protein, His-Tagged
| Cat.No. : | RFL6288BF |
| Product Overview : | Recombinant Full Length Bovine Gamma-secretase subunit PEN-2(PSENEN) Protein (Q5G235) (1-101aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-101) |
| Form : | Lyophilized powder |
| AA Sequence : | MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFIVPAYTEQSQIKGYVWRS AVGFFLWVIVLSTWITIFQIYRPRWGALGDYLSFTIPLGTP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | PSENEN |
| Synonyms | PSENEN; PEN2; Gamma-secretase subunit PEN-2; Presenilin enhancer protein 2 |
| UniProt ID | Q5G235 |
| ◆ Recombinant Proteins | ||
| RFL22065MF | Recombinant Full Length Mouse Gamma-Secretase Subunit Pen-2(Psenen) Protein, His-Tagged | +Inquiry |
| PSENEN-4419R | Recombinant Rat PSENEN Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSENEN-13547M | Recombinant Mouse PSENEN Protein | +Inquiry |
| PSENEN-11617Z | Recombinant Zebrafish PSENEN | +Inquiry |
| RFL6288BF | Recombinant Full Length Bovine Gamma-Secretase Subunit Pen-2(Psenen) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSENEN-2789HCL | Recombinant Human PSENEN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSENEN Products
Required fields are marked with *
My Review for All PSENEN Products
Required fields are marked with *



