Recombinant Full Length Bovine Glutaminyl-Peptide Cyclotransferase-Like Protein(Qpctl) Protein, His-Tagged
| Cat.No. : | RFL7482BF |
| Product Overview : | Recombinant Full Length Bovine Glutaminyl-peptide cyclotransferase-like protein(QPCTL) Protein (Q0V8G3) (1-383aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-383) |
| Form : | Lyophilized powder |
| AA Sequence : | MPSGGRGRPRLQVGERSLLERPSPPKRRLIPRAQLLPQLLLALTVASVFYTIWRIWHSQT EELPLGRELRGPLIGSLPEARVRRVVGQLDPHRLWNTFLRPLLVVRTPGSPGNLQVRKFL EATLRTLSAGWHIELDSFTASTPVGPLDFSNVVATLDPGAARHLTLACHYDSKLFPSDSA PFVGATDSAVPCSLLLELAQALDQELGKAKERAAPMTLQLIFLDGEEALKQWGPKDSLYG SRHLAQLMESTPHGLGSTRIQAIELFMLLDLLGAPNPTFYSHFPRTARWFHRLRSIEKRL HRLNLLQSHPWEVMYFQTGEPPGSVEDDHIPFLRRGVPVLHLIATPFPSVWHTSDDSEAN LHPPTVHNLSRILAVFLAEYLGL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | QPCTL |
| Synonyms | QPCTL; Glutaminyl-peptide cyclotransferase-like protein; Golgi-resident glutaminyl-peptide cyclotransferase; isoQC; gQC |
| UniProt ID | Q0V8G3 |
| ◆ Recombinant Proteins | ||
| QPCTL-1126H | Recombinant Human QPCTL Protein (212-382 aa), His-SUMO-tagged | +Inquiry |
| QPCTL-2092H | Recombinant Human QPCTL, GST-tagged | +Inquiry |
| RFL17905HF | Recombinant Full Length Human Glutaminyl-Peptide Cyclotransferase-Like Protein(Qpctl) Protein, His-Tagged | +Inquiry |
| QPCTL-16H | Recombinant Human QPCTL protein, GST-tagged | +Inquiry |
| QPCTL-3726R | Recombinant Rhesus monkey QPCTL Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| QPCTL-7323M | Recombinant Mouse QPCTL Protein, His-Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| QPCTL-2133HCL | Recombinant Human QPCTL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QPCTL Products
Required fields are marked with *
My Review for All QPCTL Products
Required fields are marked with *
