Recombinant Full Length Bovine Leucine-Rich Repeat-Containing Protein 3(Lrrc3) Protein, His-Tagged
Cat.No. : | RFL31670BF |
Product Overview : | Recombinant Full Length Bovine Leucine-rich repeat-containing protein 3(LRRC3) Protein (A6H793) (33-257aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (33-257) |
Form : | Lyophilized powder |
AA Sequence : | CPQNCQCPDHAGAVAVHCSARGLQEVPRDIPADTVLLKLDANKIARIPNGAFQHLHQLRE LDLSQNAIETIGPAAFSGLAGGLRLLDLSHNRLRRIPKDALGKLSAKIRLAHNPLHCECA LQEALWELKLDPDSVDEIACHTSVQEEYVGKPLIQALDSGVSFCSVHHKTTDVAMLVTMF GWFAMVITYVVYYVRQNQEDARRHLEYLKSLPSTPMSKDPTSSAP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LRRC3 |
Synonyms | LRRC3; Leucine-rich repeat-containing protein 3 |
UniProt ID | A6H793 |
◆ Recombinant Proteins | ||
LRRC3-3462R | Recombinant Rat LRRC3 Protein | +Inquiry |
RFL20276RF | Recombinant Full Length Rat Leucine-Rich Repeat-Containing Protein 3(Lrrc3) Protein, His-Tagged | +Inquiry |
LRRC3-2378R | Recombinant Rhesus Macaque LRRC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRC3-6356Z | Recombinant Zebrafish LRRC3 | +Inquiry |
Lrrc3-3828M | Recombinant Mouse Lrrc3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
LRRC3-001H | Recombinant Human LRRC3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC3-4637HCL | Recombinant Human LRRC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC3 Products
Required fields are marked with *
My Review for All LRRC3 Products
Required fields are marked with *