Recombinant Full Length Bovine Low-Density Lipoprotein Receptor(Ldlr) Protein, His-Tagged
| Cat.No. : | RFL14164BF |
| Product Overview : | Recombinant Full Length Bovine Low-density lipoprotein receptor(LDLR) Protein (P01131) (1-264aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-264) |
| Form : | Lyophilized powder |
| AA Sequence : | SKLHSISSIDVNGGNRKTVLEDKKKLAHPFSLAIFEDKVFWTDVINEAIFSANRLTGSDI SLMAENLLSPEDIVLFHNLTQPRGVNWCERTALRNGGCQYLCLPAPQINPRSPKFTCACP DGMLLAKDMRSCLTESESAVTTRGPSTVSSTAVGPKRTASPELTTAESVTMSQQGQGDVA SQADTERPGSVGALYIVLPIALLILLAFGTFLLWKNWRLKSINSINFDNPVYQKTTEDEV HICRSQDGYTYPSRQMVSLEDDVA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | LDLR |
| Synonyms | LDLR; Low-density lipoprotein receptor; LDL receptor |
| UniProt ID | P01131 |
| ◆ Recombinant Proteins | ||
| Ldlr-645M | Recombinant Mouse Ldlr protein, His-tagged | +Inquiry |
| Ldlr-3283M | Recombinant Mouse Ldlr protein(Met1-Arg790), His-tagged | +Inquiry |
| Ldlr-5718R | Recombinant Rat Ldlr protein, His & T7-tagged | +Inquiry |
| LDLR-348H | Recombinant Human LDLR Protein, Fc-tagged | +Inquiry |
| LDLR-275H | Recombinant Human LDLR Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Native Proteins | ||
| LDLR-85H | Native Human Lipoprotein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LDLR-2762MCL | Recombinant Mouse LDLR cell lysate | +Inquiry |
| LDLR-2780HCL | Recombinant Human LDLR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDLR Products
Required fields are marked with *
My Review for All LDLR Products
Required fields are marked with *
