Recombinant Full Length Bovine Mitochondrial Import Receptor Subunit Tom22 Homolog(Tomm22) Protein, His-Tagged
Cat.No. : | RFL21146BF |
Product Overview : | Recombinant Full Length Bovine Mitochondrial import receptor subunit TOM22 homolog(TOMM22) Protein (A6QPI6) (1-140aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-140) |
Form : | Lyophilized powder |
AA Sequence : | MAAAAAGPGAPLSADELLPKGDAEKPEEELEEEDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TOMM22 |
Synonyms | TOMM22; Mitochondrial import receptor subunit TOM22 homolog; Translocase of outer membrane 22 kDa subunit homolog |
UniProt ID | A6QPI6 |
◆ Recombinant Proteins | ||
TOMM22-4893R | Recombinant Rhesus monkey TOMM22 Protein, His-tagged | +Inquiry |
TOMM22-17219M | Recombinant Mouse TOMM22 Protein | +Inquiry |
TOMM22-5874R | Recombinant Rat TOMM22 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOMM22-4707R | Recombinant Rhesus Macaque TOMM22 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOMM22-6861HF | Recombinant Full Length Human TOMM22 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOMM22-871HCL | Recombinant Human TOMM22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOMM22 Products
Required fields are marked with *
My Review for All TOMM22 Products
Required fields are marked with *
0
Inquiry Basket