Recombinant Full Length Bovine Pdzk1-Interacting Protein 1(Pdzk1Ip1) Protein, His-Tagged
Cat.No. : | RFL29113BF |
Product Overview : | Recombinant Full Length Bovine PDZK1-interacting protein 1(PDZK1IP1) Protein (Q2KIP5) (1-114aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-114) |
Form : | Lyophilized powder |
AA Sequence : | MSVLSLVVLSLLMALPPASCQQGRGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEKPA PINMVMTIGNKADGILVGTDGKYSSMAASFRSSEHENAYENIPEEEGKVCSTPM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PDZK1IP1 |
Synonyms | PDZK1IP1; PDZK1-interacting protein 1 |
UniProt ID | Q2KIP5 |
◆ Recombinant Proteins | ||
RFL20924HF | Recombinant Full Length Human Pdzk1-Interacting Protein 1(Pdzk1Ip1) Protein, His-Tagged | +Inquiry |
PDZK1IP1-3366R | Recombinant Rhesus monkey PDZK1IP1 Protein, His-tagged | +Inquiry |
PDZK1IP1-4976C | Recombinant Chicken PDZK1IP1 | +Inquiry |
Pdzk1ip1-4785M | Recombinant Mouse Pdzk1ip1 Protein, Myc/DDK-tagged | +Inquiry |
RFL29113BF | Recombinant Full Length Bovine Pdzk1-Interacting Protein 1(Pdzk1Ip1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDZK1IP1-3313HCL | Recombinant Human PDZK1IP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDZK1IP1 Products
Required fields are marked with *
My Review for All PDZK1IP1 Products
Required fields are marked with *
0
Inquiry Basket