Recombinant Full Length Bovine Peroxisomal Membrane Protein 11A(Pex11A) Protein, His-Tagged
Cat.No. : | RFL36494BF |
Product Overview : | Recombinant Full Length Bovine Peroxisomal membrane protein 11A(PEX11A) Protein (Q0VCP2) (1-247aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-247) |
Form : | Lyophilized powder |
AA Sequence : | MDAFIRFTNQTQGRDRLFRATQYTCMLLRYLLEPKADNEKVVMKLKKLESSVSTGRKWFR LGNVVHALQATQQSVRATDLVPRICLTLASLNRVIYFICDTVLFVRSTGLASGVNKEKWR RWAARYYYYSLLLSLVRDLYEVSLQMKQVAHDRAKREKSPSQDTLGYSVADEETEWLQSL LLLLFHSLKRHPPLFLDTVKNFCDILNPLDQLGIYKSNPGIIGLGGLVSSVAGIITVAYP QMKLKTQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PEX11A |
Synonyms | PEX11A; Peroxisomal membrane protein 11A; Peroxin-11A; Peroxisomal biogenesis factor 11A |
UniProt ID | Q0VCP2 |
◆ Recombinant Proteins | ||
PEX11A-5959Z | Recombinant Zebrafish PEX11A | +Inquiry |
PEX11A-4380R | Recombinant Rat PEX11A Protein | +Inquiry |
PEX11A-6643M | Recombinant Mouse PEX11A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL5364RF | Recombinant Full Length Rat Peroxisomal Membrane Protein 11A(Pex11A) Protein, His-Tagged | +Inquiry |
PEX11A-584H | Recombinant Human PEX11A Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEX11A-479HCL | Recombinant Human PEX11A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PEX11A Products
Required fields are marked with *
My Review for All PEX11A Products
Required fields are marked with *
0
Inquiry Basket