Recombinant Full Length Bovine Prostaglandin D2 Receptor(Ptgdr) Protein, His-Tagged
Cat.No. : | RFL31280BF |
Product Overview : | Recombinant Full Length Bovine Prostaglandin D2 receptor(PTGDR) Protein (A5D7K8) (1-361aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-361) |
Form : | Lyophilized powder |
AA Sequence : | MRPLFYRCHNTTSVEKGNSATMGGVLFSTGLVGNLLALGLLARSGLGSCPPRSPRPPPSV FYVLVFGLTITDLLGKCLVSPFVLSAYAQNRSLRELVPGSDSSLCQAFAFIMSFFGLAST LQLLAMALECWLSLGHPFFHRRHLTPRRGAMVAPVVGAFCLAFCALPLVGFGKFVQYCPG TWCFFQMVHEERSLSVLSYSVLYASLMLLLVLAIVLCNLSAMRNLYAMHLRLRGLLRPGS RERAEPGAGEREATPLHLEELDHLLLLALMTVLFTMCSLPLIYRAYYGAFKAVPEQNGTT EETEDLRALRFLSVISIVDPWIFIIFRTSVFRMFFRKIFIRPLIYRNWHSNSCQTNMESS L |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTGDR |
Synonyms | PTGDR; Prostaglandin D2 receptor; PGD receptor; PGD2 receptor; Prostanoid DP receptor |
UniProt ID | A5D7K8 |
◆ Recombinant Proteins | ||
RFL10774MF | Recombinant Full Length Mouse Prostaglandin D2 Receptor(Ptgdr) Protein, His-Tagged | +Inquiry |
PTGDR-13634M | Recombinant Mouse PTGDR Protein | +Inquiry |
PTGDR-31204TH | Recombinant Human PTGDR | +Inquiry |
PTGDR-3232H | Recombinant Human PTGDR protein, His&Myc-tagged | +Inquiry |
PTGDR-4802R | Recombinant Rat PTGDR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGDR-2719HCL | Recombinant Human PTGDR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTGDR Products
Required fields are marked with *
My Review for All PTGDR Products
Required fields are marked with *
0
Inquiry Basket