Recombinant Full Length Bovine Serine Palmitoyltransferase Small Subunit B(Sptssb) Protein, His-Tagged
| Cat.No. : | RFL27432BF |
| Product Overview : | Recombinant Full Length Bovine Serine palmitoyltransferase small subunit B(SPTSSB) Protein (Q0IIK4) (1-76aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-76) |
| Form : | Lyophilized powder |
| AA Sequence : | MDFKRVKDYLSWLYYQYQIISCCAVLEPWEQSMFNTIILTIFAMVVYTAYVFIPIHIRLA WEFFSKMCGYHSTISN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SPTSSB |
| Synonyms | SPTSSB; ADMP; SSSPTB; Serine palmitoyltransferase small subunit B; Protein ADMP; Small subunit of serine palmitoyltransferase B; ssSPTb |
| UniProt ID | Q0IIK4 |
| ◆ Recombinant Proteins | ||
| SPTSSB-5605C | Recombinant Chicken SPTSSB | +Inquiry |
| SPTSSB-1381H | Recombinant Human SPTSSB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SPTSSB-4458R | Recombinant Rhesus monkey SPTSSB Protein, His-tagged | +Inquiry |
| RFL23193XF | Recombinant Full Length Xenopus Tropicalis Serine Palmitoyltransferase Small Subunit B(Sptssb) Protein, His-Tagged | +Inquiry |
| SPTSSB-8698M | Recombinant Mouse SPTSSB Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPTSSB-8041HCL | Recombinant Human C3orf57 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPTSSB Products
Required fields are marked with *
My Review for All SPTSSB Products
Required fields are marked with *
