Recombinant Full Length Xenopus Tropicalis Serine Palmitoyltransferase Small Subunit B(Sptssb) Protein, His-Tagged
Cat.No. : | RFL23193XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Serine palmitoyltransferase small subunit B(sptssb) Protein (B0S4Q1) (1-80aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-80) |
Form : | Lyophilized powder |
AA Sequence : | MDVKHIKDYLSWLYYQYLLITCSYVLEPWEQSIFNTLLLTIIAMVIYSSYIFIPIHVRLA VEFFSGIFGGQHESTVALMS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sptssb |
Synonyms | sptssb; admp; sssptb; Serine palmitoyltransferase small subunit B; Protein ADMP; Small subunit of serine palmitoyltransferase B; ssSPTb |
UniProt ID | B0S4Q1 |
◆ Recombinant Proteins | ||
SPTSSB-15959M | Recombinant Mouse SPTSSB Protein | +Inquiry |
SPTSSB-5606C | Recombinant Chicken SPTSSB | +Inquiry |
SPTSSB-4458R | Recombinant Rhesus monkey SPTSSB Protein, His-tagged | +Inquiry |
SPTSSB-3892HF | Recombinant Full Length Human SPTSSB Protein, GST-tagged | +Inquiry |
RFL23193XF | Recombinant Full Length Xenopus Tropicalis Serine Palmitoyltransferase Small Subunit B(Sptssb) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPTSSB-8041HCL | Recombinant Human C3orf57 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All sptssb Products
Required fields are marked with *
My Review for All sptssb Products
Required fields are marked with *
0
Inquiry Basket