Recombinant Full Length Bovine Somatostatin Receptor Type 2(Sstr2) Protein, His-Tagged
Cat.No. : | RFL9057BF |
Product Overview : | Recombinant Full Length Bovine Somatostatin receptor type 2(SSTR2) Protein (P34993) (1-368aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-368) |
Form : | Lyophilized powder |
AA Sequence : | MDLVSELNETQPWLTTPFDLNGSVGAANISNQTEPYYDLASNVVLTFIYFVVCIIGLCGN TLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTV DGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYA GLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGIR VGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVVLT YANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLL NGDLQTSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SSTR2 |
Synonyms | SSTR2; Somatostatin receptor type 2; SS-2-R; SS2-R; SS2R; SRIF-1 |
UniProt ID | P34993 |
◆ Recombinant Proteins | ||
SSTR2-2738H | Recombinant Human SSTR2 Protein, His-tagged | +Inquiry |
SSTR2-6731H | Active Recombinant Human SSTR2 Full Length Transmembrane protein(MNP) | +Inquiry |
SSTR2-809H | Active Recombinant Human SSTR2 protein(VLPs) | +Inquiry |
SSTR2-147HFL | Recombinant Full Length Human SSTR2 Protein, C-Flag-tagged | +Inquiry |
SSTR2-16043M | Recombinant Mouse SSTR2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSTR2-1452HCL | Recombinant Human SSTR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSTR2 Products
Required fields are marked with *
My Review for All SSTR2 Products
Required fields are marked with *
0
Inquiry Basket