Recombinant Full Length Bovine Transmembrane 4 L6 Family Member 18(Tm4Sf18) Protein, His-Tagged
Cat.No. : | RFL26805BF |
Product Overview : | Recombinant Full Length Bovine Transmembrane 4 L6 family member 18(TM4SF18) Protein (Q3T110) (1-201aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-201) |
Form : | Lyophilized powder |
AA Sequence : | MGSRKCGSCLSSLLIPLALWSIIVNILLYFPNGQASYASSNKLTNYVWYFEGICFSGIMM LVVAAVLLVLENDNNYKCCQSENCSKKYMTVLSMIFSALGIAFSGYCLVISALGLLQGPY CRTLDGWEYAFEGTAGRFLTDSREWIQCLEPAHVVEWNIILFSILIALSGLQVIVCLIRV VIQLSKSLCGTYSVIIQPGII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TM4SF18 |
Synonyms | TM4SF18; Transmembrane 4 L6 family member 18 |
UniProt ID | Q3T110 |
◆ Recombinant Proteins | ||
TM4SF18-4096Z | Recombinant Zebrafish TM4SF18 | +Inquiry |
TM4SF18-4555R | Recombinant Rhesus Macaque TM4SF18 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL26805BF | Recombinant Full Length Bovine Transmembrane 4 L6 Family Member 18(Tm4Sf18) Protein, His-Tagged | +Inquiry |
TM4SF18-4741R | Recombinant Rhesus monkey TM4SF18 Protein, His-tagged | +Inquiry |
RFL24186HF | Recombinant Full Length Human Transmembrane 4 L6 Family Member 18(Tm4Sf18) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TM4SF18-668HCL | Recombinant Human TM4SF18 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TM4SF18 Products
Required fields are marked with *
My Review for All TM4SF18 Products
Required fields are marked with *
0
Inquiry Basket