Recombinant Full Length Bovine Transmembrane Protein 189(Tmem189) Protein, His-Tagged
Cat.No. : | RFL6050BF |
Product Overview : | Recombinant Full Length Bovine Transmembrane protein 189(TMEM189) Protein (A6QLM0) (1-271aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-271) |
Form : | Lyophilized powder |
AA Sequence : | MAGAEDGPGQQPELEDDEAASCRRWGAQHAGARELAALYSPGKRFQEWCCVVLCFSLIAH NMAHLLLLARWEHTPLVMLGMVAGALLADFLSGLVHWGADTWGSVELPIVGKAFIRPFRE HHIDPTAITRHDFIETNGDNCLLTLLPLLNMAYKFRTQSPEVLEQLYPWECFVFCLIIFG TFTNQIHKWSHTYFGLPCWVVFLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLER MGFWRRLEDIIQALTGEKPRADDMKWAQKIK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM189 |
Synonyms | PEDS1; PDES; TMEM189; Plasmanylethanolamine desaturase; Plasmanylethanolamine desaturase 1; Transmembrane protein 189 |
UniProt ID | A6QLM0 |
◆ Recombinant Proteins | ||
RFL24520MF | Recombinant Full Length Mouse Transmembrane Protein 189(Tmem189) Protein, His-Tagged | +Inquiry |
TMEM189-4509C | Recombinant Chicken TMEM189 | +Inquiry |
TMEM189-16970M | Recombinant Mouse TMEM189 Protein | +Inquiry |
TMEM189-276H | Recombinant Human TMEM189 Protein, His-tagged | +Inquiry |
TMEM189-1564Z | Recombinant Zebrafish TMEM189 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM189-977HCL | Recombinant Human TMEM189 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM189 Products
Required fields are marked with *
My Review for All TMEM189 Products
Required fields are marked with *
0
Inquiry Basket