Recombinant Human TMEM189 Protein, His-tagged

• Cat.No.: TMEM189-276H
• Product Overview: Recombinant Human TMEM189 fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The TMEM189-UEV mRNA is an infrequent but naturally occurring read-through transcript of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this read-through mRNA and the function of its protein product has not yet been determined.
• Form: Supplied as a 0.2 µM filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0
• Molecular Mass: 17.5kD
• AA Sequence: MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSNLEHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: TMEM189 transmembrane protein 189 [ Homo sapiens ]
• Official Symbol: TMEM189
• Synonyms: KUA; TMEM189; transmembrane protein 189
• Gene ID: 387521
• mRNA Refseq: NM_001162505
• Protein Refseq: NP_001155977