Recombinant Human TMEM189 Protein, His-tagged
Cat.No. : | TMEM189-276H |
Product Overview : | Recombinant Human TMEM189 fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The TMEM189-UEV mRNA is an infrequent but naturally occurring read-through transcript of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this read-through mRNA and the function of its protein product has not yet been determined. |
Form : | Supplied as a 0.2 µM filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0 |
Molecular Mass : | 17.5kD |
AA Sequence : | MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSNLEHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | TMEM189 transmembrane protein 189 [ Homo sapiens ] |
Official Symbol | TMEM189 |
Synonyms | KUA; TMEM189; transmembrane protein 189 |
Gene ID | 387521 |
mRNA Refseq | NM_001162505 |
Protein Refseq | NP_001155977 |
◆ Recombinant Proteins | ||
TMEM189-276H | Recombinant Human TMEM189 Protein, His-tagged | +Inquiry |
TMEM189-4610R | Recombinant Rhesus Macaque TMEM189 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL24520MF | Recombinant Full Length Mouse Transmembrane Protein 189(Tmem189) Protein, His-Tagged | +Inquiry |
TMEM189-269H | Recombinant Human TMEM189 Protein, MYC/DDK-tagged | +Inquiry |
TMEM189-4796R | Recombinant Rhesus monkey TMEM189 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM189-977HCL | Recombinant Human TMEM189 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM189 Products
Required fields are marked with *
My Review for All TMEM189 Products
Required fields are marked with *
0
Inquiry Basket