Recombinant Human TMEM189 Protein, His-tagged

Cat.No. : TMEM189-276H
Product Overview : Recombinant Human TMEM189 fused with His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The TMEM189-UEV mRNA is an infrequent but naturally occurring read-through transcript of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this read-through mRNA and the function of its protein product has not yet been determined.
Form : Supplied as a 0.2 µM filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0
Molecular Mass : 17.5kD
AA Sequence : MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSNLEHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name TMEM189 transmembrane protein 189 [ Homo sapiens ]
Official Symbol TMEM189
Synonyms KUA; TMEM189; transmembrane protein 189
Gene ID 387521
mRNA Refseq NM_001162505
Protein Refseq NP_001155977

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM189 Products

Required fields are marked with *

My Review for All TMEM189 Products

Required fields are marked with *

0
cart-icon
0
compare icon